The short version of Ac-SDKP fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-01-13 and is reviewed periodically as new material appears.
TB-500 is a synthetic seven-amino-acid peptide with the sequence LKKTETQ, corresponding to residues 17 through 23 of the protein thymosin beta-4. The N-terminus is typically acetylated in the described form, giving a monoisotopic mass near 888.5 Da and an average mass of about 889 Da. The designation TB-500 is a catalogue label rather than a formal chemical name, and the same sequence appears in the literature under several alternative abbreviations. It is handled as a research reagent rather than a pharmaceutical product.
Thymosin beta-4 is a 43-residue actin-binding protein found in most mammalian cell types, where it participates in cytoskeletal regulation and cell migration. TB-500 represents only a short fragment of that protein and does not include the remaining residues. Whether the isolated fragment reproduces the full range of activities reported for the intact protein remains an open question. Researchers commonly treat the two as related but distinct entities when comparing results.
Published work involving this sequence spans actin-binding assays, cell-migration studies, wound-healing models, and cardiovascular or musculoskeletal experiments. Much of the biological rationale derives from in vitro systems and animal models, and the number of controlled human studies is small. Reported outcomes vary across preparations, doses, and routes, which complicates comparison between studies. Reviews generally describe the evidence base as preliminary rather than settled. Mechanistic explanations are often proposed by analogy to the parent protein rather than demonstrated directly.
Thymosin beta-4 itself is a natural peptide of 43 residues found in many cell types and body fluids. Its best-characterised function is binding and sequestering actin monomers, which influences cytoskeletal dynamics. The sequence most often associated with TB-500, LKKTETQ, corresponds to part of that actin-binding region. A different fragment, Ac-SDKP, is also derived from the same parent peptide and is studied in its own right, which is one reason discussions of thymosin fragments can become confusing. The two are structurally distinct and are not interchangeable.
Interest in the fragment grew during the 1990s and 2000s, when it moved from laboratory work into sports and supplement markets. Anti-doping bodies added thymosin beta-4 fragments to prohibited lists, and a small number of adverse analytical findings have been reported in competition testing. Published controlled human trials remain scarce. Most mechanistic evidence comes from cell culture and animal models, and those studies examine endpoints such as cell migration, wound closure and inflammation markers. That evidence supports research interest but does not establish clinical benefit, and broad regenerative claims should be read as unverified.
TB-500 is a short synthetic peptide sold under a trade name rather than a systematic chemical name. Suppliers usually describe it as a fragment of thymosin beta-4 and ship it as a lyophilised powder intended for laboratory use. Because the label is commercial, the exact sequence attributed to it is not fully consistent across catalogues, and some listings present a seven-residue peptide while others describe related fragments of similar length. It is not an approved medicine in any major jurisdiction, and it is handled as a research chemical.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H68N10O14 | Acetylated heptapeptide form |
| Monoisotopic mass | 888.5 Da | Average mass about 889 Da |
| Appearance | White to off-white solid | Usually supplied as lyophilised powder |
| Solubility class | Highly water soluble | Also dissolves in aqueous buffers |
| Common synonyms | Tbeta4 fragment, thymosin beta-4 (17-23) | Refer to the same sequence |
TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.
Laboratory work on thymosin beta-4 describes binding to monomeric actin and effects on cell migration, angiogenesis, and inflammatory signaling in cultured cells. Animal models have examined skin, corneal, and cardiac repair after injury, with outcomes reported mainly in preclinical literature. Most of that evidence concerns the parent protein rather than preparations labelled TB-500, so extrapolation from animal findings to a specific commercial product remains uncertain. Whether the two behave identically in living systems has not been established in controlled human studies.
No major regulatory agency has approved TB-500 for therapeutic use, and it holds no pharmacopoeial monograph. The name appears on the World Anti-Doping Agency prohibited list within the class covering peptide hormones, growth factors, and related substances. Detection in doping control relies on mass spectrometric methods applied to urine, often after preparation steps that concentrate the analyte. Discussion of TB-500 therefore clusters in biochemistry, sports medicine, and anti-doping literature rather than in registered clinical trials.
Lyophilised material is stable for extended periods when kept dry and cold, and suppliers typically recommend storage well below freezing. Once dissolved, the peptide is handled at refrigeration temperatures and used within a short period, because peptide bonds and the acetylated terminus can be affected by repeated freeze-thaw cycles, proteases, or extreme pH. Bacteriostatic water and saline are both described as solvents, although preservatives can interfere with some analytical workflows. Reconstituted solutions are inspected for particulates before use.
Sports authorities classify the peptide as a prohibited substance, and it appears on the World Anti-Doping Agency list under peptide hormones, growth factors, and related substances. Racing jurisdictions for horses and dogs have issued separate restrictions, and several national bodies treat it as a controlled or prescription-only item. As a research chemical it is sold without a therapeutic indication, and labels usually state that the product is not for human or veterinary use. Regulatory treatment therefore varies by country.
Detection in biological matrices generally relies on liquid chromatography coupled with tandem mass spectrometry, because the peptide lacks a convenient ultraviolet chromophore beyond the amide backbone. Immunoassays have been described, but antibodies raised against the fragment can cross-react with the full-length protein or with unrelated peptides, so findings usually require confirmation by a second technique. Sample preparation typically involves protein precipitation followed by solid-phase extraction. Reported detection windows depend on dose, route, matrix, and instrument sensitivity.
Therefore, the HLB scale of sucrose esters as defined by suppliers up to now (March 2020) should be merely considered as an index ranking them from the most hydrophilic (high HLB) to the most lipophilic (low HLB). It is useful for comparing their properties within the sucrose ester family, but it should not be used as an experimental predictive tool for comparing their emulsifying properties to other kinds of surfactants, especially for high HLB index. The HLB scales, defined in the 1950s, have been built from experimental methods. It is notably the case of the Griffin's scale set above, that has been established experimentally by comparing the stability of emulsions involving different oils and stabilized by a large range of POE surfactants. From this large quantity of experimental data, an experimental HLB scale has been built up. Since a relationship between the surfactant structure and the results was observed, then a numerical equation has been worked out. The equation facilitated the determination of the HLB of new PEO surfactants without the need of new experiments. This calculation thus is strictly valid within the limit of the PEO surfactants family. Efforts to clarify the HLB of sucrose esters and related carbohydrate surfactants by experimental methods has been made in few works. Methods are based on the comparison of the stability of emulsions, on the "water number method" or on the "Phase Inversion Temperature" (PIT) method.
== Research == Eberlin developed a pen-like device, called the "MasSpec Pen" or "The Cancer Pen", that has demonstrated the capability to detect cancerous tissue by delivering a discrete water droplet to extract biomolecules from the tissue's surface and transporting them to a mass spectrometer for molecular analysis. The pen allows surgeons to achieve a better understanding of which tissues should be removed. As a co-principal investigator at the University of Texas at Austin, Eberlin has developed a method to detect thyroid cancer using Desorption electrospray ionization mass spectrometry (DESI-MS) imaging of fine-needle aspiration biopsies. It is two-thirds more accurate than the test already in use, fine-needle aspiration, which yields more indeterminate results when used in isolation. In addition to her work on cancer diagnosis, Eberlin has also worked with Cooks and her father on the use of mass spectrometry to quickly detect counterfeit money. Eberlin is concerned about the representation of women and diversity in science. In interviews, she has stressed the importance of women in higher levels of academia as well as leadership.
=== SIR Model on Networks === The SIR model has been studied on networks of various kinds in order to model a more realistic form of connection than the homogeneous mixing condition which is usually required. A simple model for epidemics on networks in which an individual has a probability p of being infected by each of his infected neighbors in a given time step leads to results similar to giant component formation on Erdos Renyi random graphs. A stochastic compartment model with a transmission pathway via vectors has been developed recently in which a multiple random walkers approach is implemented to investigate the spreading dynamics in random graphs of the Watts-Strogatz and the Barabási-Albert type to mimic human mobility patterns in complex real world environments such as cities, streets, and transportation networks. This model captures the class of vector transmitted infectious diseases such as Dengue, Malaria (transmission by mosquitoes), pestilence (transmission by fleas), and others.
21 July: Health Minister Simeon Brown announces that the New Zealand Government will contribute NZ$82.5 million to the establishment of the University of Waikato's medical school; with the university and private philanthropists contributing the remaining NZ$150 million. The Commerce Commission files criminal charges against electronics retailer Noel Leeming for alleged breaches of the Fair Trading Act 1986. The Gore District Council lifts its "do not drink tap water" directive for Gore. 22 July: Sky TV buys TV3 for a symbolic $1; marking the exit of Warner Bros. Discovery from New Zealand's free-to-air television space. The sale comes into effect on 1 August. New Zealand joins 24 other countries including Australia, the United Kingdom, Canada, Japan and the European Union in issuing a joint statement calling for the Gaza war to end. Representatives of several Jewish and Muslim community groups including the New Zealand Jewish Council and the Federation of Islamic Associations of New Zealand (FIANZ) sign a "harmony and peace accord" to improve interfaith relations amidst the Gaza war. 24 July — The primary school teachers' union, the New Zealand Educational Institute, files for a judicial review at the Wellington High Court of the New Zealand Government's decision to reduce funding for literacy and Māori resource teachers during the 2025 New Zealand budget, which was released in May 2025. 30 July: 36,000 nurses, midwives, and other health workers affiliated with the New Zealand Nurses Organisation strike to protest unsafe staffing levels at Te Whatu Ora facilities.
Sources: en.wikipedia.org
== Personal life == Findlay was married to lawyer A. Boyd Ferris, with whom she had two children. After Ferris died from a heart attack in 1989, she met actor Brent Chapman. The two married in 1993 and had two more daughters together; they also have nine grandchildren. Chapman was elected as the provincial MLA for Surrey South in the 2024 British Columbia general election. Findlay is a member of the All-Saints Community Church in White Rock, British Columbia, which is part of the Anglican Mission in the Americas, through its Canadian branch. Findlay's volunteer posts, in addition to the Canadian Bar Association, have included chair of the Vancouver City Planning Commission, board member of Science World, executive member of the Junior Leagues of Canada, president of Delta Zeta chapter of Alpha Gamma Delta International Fraternity, and honorary counsel for the Chinese Benevolent Association of Canada. In 2016, she was named a Distinguished Citizen by Alpha Gamma Delta. In 2001, she declared bankruptcy with more than a half million dollars in debt. She attributed the bankruptcy to a legal battle with the Musqueam First Nation.
=== Aflatoxins === Recent studies have attempted to pinpoint a relationship between kwashiorkor and high levels of aflatoxins. Aflatoxins are naturally occurring toxins produced by the mold Aspergillus flavus, a fungus found in areas with hot and humid climates. These toxins tend to grow and can be found in agricultural crops such as millet, maize, and rice. An analysis found that the presence of aflatoxins was found more frequently and in higher concentrations in individuals with kwashiorkor when compared to individuals with marasmus (another form of severe acute malnutrition). In particular, biological samples showed greater levels of aflatoxins in the brain, heart, kidney, liver, lungs, serum, stool, and urine. Aflatoxins were not found in liver samples of individuals with marasmus. It has been known that the liver organ is the main target of aflatoxins and chronic toxicity can result in immunosuppressive and carcinogenic effects. However, there is currently conflicting evidence to pinpoint a connection between kwashiorkor and aflatoxins. Studies have shown that not all children with kwashiorkor present with detectable aflatoxin levels. It has also been proposed that damage done by aflatoxins may be due to glutathione depletion (another proposed mechanism of the disease) in children with kwashiorkor.
Substitution of the poly-Pro II (φ,ψ) dihedral angles into this equation yields almost exactly Ω = -120°, i.e., the PPII helix is a left-handed helix (since Ω is negative) with three residues per turn (360°/120° = 3). The rise per residue is approximately 3.1 Å. This structure is somewhat similar to that adopted in the fibrous protein collagen, which is composed mainly of proline, hydroxyproline, and glycine. PPII helices are specifically bound by SH3 domains; this binding is important for many protein-protein interactions and even for interactions between the domains of a single protein. The PPII helix is relatively open and has no internal hydrogen bonding, as opposed to the more common helical secondary structures, the alpha helix and its relatives the 310 helix and the pi helix, as well as the β-helix. The amide nitrogen and oxygen atoms are too far apart (approximately 3.8 Å) and oriented incorrectly for hydrogen bonding. Moreover, these atoms are both H-bond acceptors in proline; there is no H-bond donor due to the cyclic side chain. The PPII backbone dihedral angles (-75°, 150°) are observed frequently in proteins, even for amino acids other than proline. The Ramachandran plot is highly populated in the PPII region, comparably to the beta sheet region around (-135°, 135°). For example, the PPII backbone dihedral angles are often observed in turns, most commonly in the first residue of a type II β-turn. The "mirror image" PPII backbone dihedral angles (75°, -150°) are rarely seen, except in polymers of the achiral amino acid glycine.
Sources: en.wikipedia.org
In addition to developing new medicines, the company achieved several technological advances, including the automation of its production facilities. Lilly was also an innovator in pill capsule manufacturing. It was among the first manufacturers to insert medications into empty gelatin capsules, which provided a more exact dosage. Lilly manufactured capsules for its own needs and sold its excess capacity to others. In 1917, Scientific American described Lilly as "the largest capsule factory in the world" and reported that the company was "capable of producing 2.5 million capsules a day". One of Lilly's early innovations was fruit flavoring for medicines and sugar-coated pills to make their medicines easier to swallow. Over the next few years, the company created tens of millions of capsules and pills annually. Other advances improved plant efficiency and eliminated production errors. In 1909, Eli Lilly, grandson of the company's founder, introduced a method for blueprinting manufacturing tickets, which created multiples copies of a drug formula and helped eliminate manufacturing and transcription errors. In 1920, Josiah hired biochemist George Henry Alexander Clowes as a research chemist; Clowes was promoted to director of biochemical research the following year. In the 1920s, Eli introduced the new concept of straight-line production to the pharmaceutical industry, where raw materials entered at one end of the facility and the finished product came out the other end, in the company's manufacturing process.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
=== Molecular structure and conformational flexibility === Lidocaine's 1,5-dimethylbenzene group gives it hydrophobic properties. In addition to this aromatic unit, lidocaine has an aliphatic section comprising amide, carbonyl, and enyl groups. Lidocaine exhibits a remarkable degree of conformational flexibility, resulting in more than 60 probable conformers. This adaptability arises from the high lability of the amide and ethyl groups within the molecule. These groups can undergo shifts in their positions, leading to significant variations in the overall molecular configuration.
=== 1963 === January 20: Indonesia declares that it rejects the formation of Malaysia, through the statement of their then-Minister of Foreign Affairs, Subandrio. Sukarno himself, as the first President of Indonesia, regarded Malaysia as a neo-colonial project and as a British puppet state in Southeast Asia. This marks the beginning of Indonesia-Malaysia confrontation. January 23: Kim Philby, the leader of the Cambridge Five, defects to the Soviet Union from Beirut. The fight for independence in Portuguese Guinea begins. February 10: the overthrow of Abd al-Karim Qasim. June 9: The Dhofar Liberation Front wages a war in Oman known as the Dhofar Rebellion. June 13: Mars 1 likely reaches Mars conducting flyby. Yet, radio contact was lost with the probe on March 21. June 16: Vostok 6 was launched, with Valentina Tereshkova becoming the first woman in space. June 20: The United States agrees to set up a hotline with the USSR, thus making direct communication possible. June 21: France announces that it is withdrawing its navy from the North Atlantic fleet of NATO. June 26: U.S. President John F. Kennedy delivers his "Ich bin ein Berliner" speech in Berlin. July 31: The Manila Accord was signed by the Republic of Indonesia, the Federation of Malaya (soon to become Malaysia), and the Philippines. This agreement contains an agreement on self-determination by the people of Sabah and Sarawak through free elections. A conference called Maphilindo was formed, which consisted of three countries that signed the Manila Accord.
Sources: en.wikipedia.org
No. TB-500 is a short synthetic peptide matching residues 17 to 23 of thymosin beta-4, while the parent protein contains 43 residues. The fragment lacks the rest of the protein sequence, so the two are related but not identical.
It consists of leucine, lysine, lysine, threonine, glutamic acid, threonine, and glutamine in that order. The N-terminal leucine is usually acetylated in the forms described in catalogues.
Controlled human data is limited, and most published findings come from cell culture or animal work. This makes it difficult to state clinical effects with confidence.
No. Thymosin beta-4 is a 43-residue natural peptide, while TB-500 is a commercial label applied to a short synthetic fragment of it. The two differ in length, sequence coverage and how they are handled in the laboratory.